PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009762628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 755aa    MW: 82838.6 Da    PI: 5.7631
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009762628.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.39e-1023937542374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +++L+++Ae v++g+  laq +Larl+++ sp g+p+ R+a+y +eAL+  l+ ++++l +   ps++ + n + ++ a+k fse+sP+ +f+++
  XP_009762628.1 393 IDQLFKAAELVQTGNPVLAQGILARLNHQLSPIGKPFYRAAFYCKEALQLLLHTNTNNLNNPSIPSSS-PFNLIFKIGAYKSFSEISPVAQFANF 486
                     689***************************************************88888876655555.478*********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     t+Nqa+le ++g er+Hi+Dfdi++G QW++L+q+La R++g+p+l+iT+++sp+++++ el  t+e L +fA+e++++fef++l  ++l++   
  XP_009762628.1 487 TCNQALLEVLDGFERIHIVDFDIGYGRQWASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRESLIHFANEINMEFEFEILSIDSLNST-S 580
                     ************************************************************************************977766665.4 PP

            GRAS 192 eeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++L   v+++Ea+aVnl ++    +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F +++++ l+ ys l++sl+a    + ++ +k
  XP_009762628.1 581 WSLppLVSENEAIAVNLPISSLASY--QLSLPL----VLRFVKQLSPRIVVSVDKGCDRTDLPFPNHVIQILQSYSNLLESLDAV-NVNFDALQK 668
                     555334788**********766666..566655....*********************************************665.3466999** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +Er+ll+++i+ +v+ + ++     e+ ++Wr+ + ++G++p+p+s+++++qa++++++++++g++ve+++ slvl+W++++L+s+SaWr
  XP_009762628.1 669 IERFLLQPRIERIVMSRFRS----PEKTQHWRALFLSSGLSPLPFSNFTESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWR 754
                     **************998887....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.626366734IPR005202Transcription factor GRAS
PfamPF035143.1E-99393754IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MKGMPLPFDF EGKGVLDLDV VLNKNSILNS WNYNSKESCY LVNSPSAVLD IIRSPRPVTS  60
SSTLSSSLGG GGGGGGGTAS TDTAGAVSAN PSSKWQQQQQ QQDNTTATSS NVGGAAAESE  120
FQQVAAASAA ATEGKKCAME EWEGGLSESV MASPCQEQSI LGWIMGDVDD PSMSNLNKVL  180
QVSGPMDYEF NAGFGVVDQG FGVDQIGTSS FMPAINNSSV SSFPPTSTRM NNDKIGLFSN  240
IPTNLSQNPI FPSFSNNLGP VSFSQTQQQP FESTDLKPQS FHSQFLINQH QTQIPQNPSF  300
LLPLPFAQQE QNLVLPPKAK RHNPGTLEQQ GSQISQELFI DAGQQQPTPS HQLQLLPHFR  360
PGVPIGTKPK MVGEEMGQFH QLQLQQQQQQ AIIDQLFKAA ELVQTGNPVL AQGILARLNH  420
QLSPIGKPFY RAAFYCKEAL QLLLHTNTNN LNNPSIPSSS PFNLIFKIGA YKSFSEISPV  480
AQFANFTCNQ ALLEVLDGFE RIHIVDFDIG YGRQWASLMQ ELALRSGGAP TLKITALASP  540
STHDQLELGL TRESLIHFAN EINMEFEFEI LSIDSLNSTS WSLPPLVSEN EAIAVNLPIS  600
SLASYQLSLP LVLRFVKQLS PRIVVSVDKG CDRTDLPFPN HVIQILQSYS NLLESLDAVN  660
VNFDALQKIE RFLLQPRIER IVMSRFRSPE KTQHWRALFL SSGLSPLPFS NFTESQAECV  720
VKRTPVRGFH VEKRQSSLVL CWQRKELISA SAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-363927544375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762628.10.0PREDICTED: scarecrow-like protein 22
TrEMBLA0A0V0IWJ20.0A0A0V0IWJ2_SOLCH; Putative scarecrow-like protein 22-like
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-133GRAS family protein